Lineage for d1clc_2 (1clc 35-134)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein CelD cellulase, N-terminal domain [49231] (1 species) Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry) 
Domain d1clc_2: 1clc 35-134 [21872]
Other proteins in same PDB: d1clc_1
Details for d1clc_2
PDB Entry: 1clc (more details), 1.9 Å
PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution
SCOP Domain Sequences for d1clc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clc_2 b.1.1.5 (35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum}
ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat
smfdndtketvyiadfssvneegtyylavpgvgksvnfki
SCOP Domain Coordinates for d1clc_2:
Click to download the PDB-style file with coordinates for d1clc_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clc_2:
- d1clc_2 first appeared (with stable ids) in SCOP 1.55
- d1clc_2 appears in SCOP 1.59
- d1clc_2 appears in SCOP 1.63
- d1clc_2 appears in the current release, SCOPe 2.08, called d1clca2
View in 3D
