![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein CelD cellulase, N-terminal domain [49231] (1 species) precedes the catalytic alpha6/alpha6 domain |
![]() | Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry) |
![]() | Domain d1clca2: 1clc A:35-134 [21872] Other proteins in same PDB: d1clca1 complexed with ca, zn |
PDB Entry: 1clc (more details), 1.9 Å
SCOPe Domain Sequences for d1clca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clca2 b.1.18.2 (A:35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum [TaxId: 1515]} ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat smfdndtketvyiadfssvneegtyylavpgvgksvnfki
Timeline for d1clca2: