Lineage for d1clc_2 (1clc 35-134)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291541Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 291554Protein CelD cellulase, N-terminal domain [49231] (1 species)
    precedes the catalytic alpha6/alpha6 domain
  7. 291555Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry)
  8. 291556Domain d1clc_2: 1clc 35-134 [21872]
    Other proteins in same PDB: d1clc_1
    complexed with ca, zn

Details for d1clc_2

PDB Entry: 1clc (more details), 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution

SCOP Domain Sequences for d1clc_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clc_2 b.1.18.2 (35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum}
ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat
smfdndtketvyiadfssvneegtyylavpgvgksvnfki

SCOP Domain Coordinates for d1clc_2:

Click to download the PDB-style file with coordinates for d1clc_2.
(The format of our PDB-style files is described here.)

Timeline for d1clc_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clc_1