Lineage for d3ztcd_ (3ztc D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931370Domain d3ztcd_: 3ztc D: [218461]
    Other proteins in same PDB: d3ztcb_, d3ztcc_, d3ztce_, d3ztcf_, d3ztch_, d3ztci_, d3ztck_, d3ztcl_
    automated match to d1lm8b_
    complexed with tr0

Details for d3ztcd_

PDB Entry: 3ztc (more details), 2.65 Å

PDB Description: pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
PDB Compounds: (D:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3ztcd_:

Sequence, based on SEQRES records: (download)

>d3ztcd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpd

Sequence, based on observed residues (ATOM records): (download)

>d3ztcd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafrdtfealciepfssppelpd

SCOPe Domain Coordinates for d3ztcd_:

Click to download the PDB-style file with coordinates for d3ztcd_.
(The format of our PDB-style files is described here.)

Timeline for d3ztcd_: