Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d3ztcg_: 3ztc G: [218464] Other proteins in same PDB: d3ztcb_, d3ztcc_, d3ztce_, d3ztcf_, d3ztch_, d3ztci_, d3ztck_, d3ztcl_ automated match to d1lm8b_ complexed with tr0 |
PDB Entry: 3ztc (more details), 2.65 Å
SCOPe Domain Sequences for d3ztcg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztcg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp
Timeline for d3ztcg_: