Lineage for d3ztch_ (3ztc H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945695Domain d3ztch_: 3ztc H: [218465]
    Other proteins in same PDB: d3ztca_, d3ztcc_, d3ztcd_, d3ztcf_, d3ztcg_, d3ztci_, d3ztcj_, d3ztcl_
    automated match to d2c9wc_
    complexed with tr0

Details for d3ztch_

PDB Entry: 3ztc (more details), 2.65 Å

PDB Description: pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
PDB Compounds: (H:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3ztch_:

Sequence, based on SEQRES records: (download)

>d3ztch_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d3ztch_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d3ztch_:

Click to download the PDB-style file with coordinates for d3ztch_.
(The format of our PDB-style files is described here.)

Timeline for d3ztch_: