Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d3ztcb_: 3ztc B: [218459] Other proteins in same PDB: d3ztca_, d3ztcc_, d3ztcd_, d3ztcf_, d3ztcg_, d3ztci_, d3ztcj_, d3ztcl_ automated match to d2c9wc_ complexed with tr0 |
PDB Entry: 3ztc (more details), 2.65 Å
SCOPe Domain Sequences for d3ztcb_:
Sequence, based on SEQRES records: (download)
>d3ztcb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d3ztcb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns steipefpiapeialellmaanfldc
Timeline for d3ztcb_: