| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
| Domain d2c9wc_: 2c9w C: [130146] Other proteins in same PDB: d2c9wa1, d2c9wa2, d2c9wb_ automated match to d1lm8c_ complexed with ni, so4 |
PDB Entry: 2c9w (more details), 1.9 Å
SCOPe Domain Sequences for d2c9wc_:
Sequence, based on SEQRES records: (download)
>d2c9wc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d2c9wc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryteipe
fpiapeialellmaanfldc
Timeline for d2c9wc_: