Lineage for d3ztcc_ (3ztc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768930Protein automated matches [193392] (1 species)
    not a true protein
  7. 2768931Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2768948Domain d3ztcc_: 3ztc C: [218460]
    Other proteins in same PDB: d3ztca_, d3ztcb_, d3ztcd_, d3ztce_, d3ztcg_, d3ztch_, d3ztcj_, d3ztck_
    automated match to d4awjf_
    complexed with tr0

Details for d3ztcc_

PDB Entry: 3ztc (more details), 2.65 Å

PDB Description: pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d3ztcc_:

Sequence, based on SEQRES records: (download)

>d3ztcc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

Sequence, based on observed residues (ATOM records): (download)

>d3ztcc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslndgqpifanitlpvytlkerclqvvrslvkpenyrrldivrs
lyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d3ztcc_:

Click to download the PDB-style file with coordinates for d3ztcc_.
(The format of our PDB-style files is described here.)

Timeline for d3ztcc_: