![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
![]() | Domain d3k8zf2: 3k8z F:189-423 [212224] Other proteins in same PDB: d3k8za1, d3k8zb1, d3k8zc1, d3k8zd1, d3k8ze1, d3k8zf1 automated match to d1euza1 |
PDB Entry: 3k8z (more details), 2.4 Å
SCOPe Domain Sequences for d3k8zf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8zf2 c.2.1.0 (F:189-423) automated matches {Bacillus subtilis [TaxId: 1423]} lggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvg isdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvpaaienqit eenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfewvqnnqgf ywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfrgwi
Timeline for d3k8zf2: