SCOPe 2.08: Domain d3k8zf2: 3k8z F:189-423

Lineage for d3k8zf2 (3k8z F:189-423)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)

8. Domain d3k8zf2: 3k8z F:189-423 [212224]
   Other proteins in same PDB: d3k8za1, d3k8zb1, d3k8zc1, d3k8zd1, d3k8ze1, d3k8zf1
   automated match to d1euza1

Details for d3k8zf2

PDB Entry: 3k8z, 2.4 Å

PDB Description: Crystal Structure of Gudb1 a decryptified secondary glutamate dehydrogenase from B. subtilis

PDB Compounds: (F:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k8zf2:

Sequence; same for both SEQRES and ATOM records:

>d3k8zf2 c.2.1.0 (F:189-423) automated matches {Bacillus subtilis [TaxId: 1423]}
lggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvg
isdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvpaaienqit
eenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfewvqnnqgf
ywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfrgwi

Timeline for d3k8zf2:

• d3k8zf2 first appeared in SCOPe 2.03
  
• d3k8zf2 appears in SCOPe 2.07