| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
| Protein automated matches [226864] (40 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries) |
| Domain d3k8ze1: 3k8z E:17-188 [212221] Other proteins in same PDB: d3k8za2, d3k8zb2, d3k8zc2, d3k8zd2, d3k8ze2, d3k8zf2 automated match to d1euza2 |
PDB Entry: 3k8z (more details), 2.4 Å
SCOPe Domain Sequences for d3k8ze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8ze1 c.58.1.0 (E:17-188) automated matches {Bacillus subtilis [TaxId: 1423]}
vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplv
Timeline for d3k8ze1: