PDB entry 3k8z

View 3k8z on RCSB PDB site
Description: Crystal Structure of Gudb1 a decryptified secondary glutamate dehydrogenase from B. subtilis
Class: oxidoreductase
Keywords: GudB, Glutamate dehydrogenase, NAD, Oxidoreductase
Deposited on 2009-10-15, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8za1, d3k8za2
  • Chain 'B':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8zb1, d3k8zb2
  • Chain 'C':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8zc1, d3k8zc2
  • Chain 'D':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8zd1, d3k8zd2
  • Chain 'E':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8ze1, d3k8ze2
  • Chain 'F':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k8zf1, d3k8zf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k8zA (A:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zA (A:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidcdilvpaaienqiteenahnirakivveaangpttlegtkilsdrdillvp
    dvlasaggvtvsyfewvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaa
    ymvgvrkmaeasrfrgwi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k8zB (B:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zB (B:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidylldrtnqelleldcdilvpaaienqiteenahnirakivveaangpttle
    gtkilsdrdillvpdvlasaggvtvsyfewvqnnqgfywseeeveeklekmmvksfnniy
    emannrridmrlaaymvgvrkmaeasrfrgwi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k8zC (C:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zC (C:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvpaaienqiteenahnir
    akivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfewvqnnqgfywseeeve
    eklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfrgwi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k8zD (D:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zD (D:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidcdilvpaaienqiteenahnirakivveaangpttlegtkilsdrdillvp
    dvlasaggvtvsyfewvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaa
    ymvgvrkmaeasrfrgwi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k8zE (E:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zE (E:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidylldrtnqelleldcdilvpaaienqiteenahnirakivveaangpttle
    gtkilsdrdillvpdvlasaggvtvsyfewvqnnqgfywseeeveeklekmmvksfnniy
    emannrridmrlaaymvgvrkmaeasrfrgwi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3k8zF (F:)
    maadrntghteedkldvlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddg
    svkiftgyrahndsvgptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivc
    dprdmsfrelerlsrgyvraisqivgptkdvpapdvftnsqimawmmdeysridefnspg
    fitgkplvlggshgresatakgvticikeaakkrgidikgarvvvqgfgnagsylakfmh
    dagakvvgisdaygglydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvp
    aaienqiteenahnirakivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfe
    wvqnnqgfywseeeveeklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfr
    gwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8zF (F:)
    vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
    ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
    yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplvlggshgre
    satakgvticikeaakkrgidikgarvvvqgfgnagsylakfmhdagakvvgisdayggl
    ydpegldidylldrrdsfgtvtklfndtitnqelleldcdilvpaaienqiteenahnir
    akivveaangpttlegtkilsdrdillvpdvlasaggvtvsyfewvqnnqgfywseeeve
    eklekmmvksfnniyemannrridmrlaaymvgvrkmaeasrfrgwi