Lineage for d3k8zd1 (3k8z D:17-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890656Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries)
  8. 2890666Domain d3k8zd1: 3k8z D:17-188 [212219]
    Other proteins in same PDB: d3k8za2, d3k8zb2, d3k8zc2, d3k8zd2, d3k8ze2, d3k8zf2
    automated match to d1euza2

Details for d3k8zd1

PDB Entry: 3k8z (more details), 2.4 Å

PDB Description: Crystal Structure of Gudb1 a decryptified secondary glutamate dehydrogenase from B. subtilis
PDB Compounds: (D:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k8zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k8zd1 c.58.1.0 (D:17-188) automated matches {Bacillus subtilis [TaxId: 1423]}
vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg
ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg
yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplv

SCOPe Domain Coordinates for d3k8zd1:

Click to download the PDB-style file with coordinates for d3k8zd1.
(The format of our PDB-style files is described here.)

Timeline for d3k8zd1: