![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries) |
![]() | Domain d3k8zc1: 3k8z C:17-188 [212217] Other proteins in same PDB: d3k8za2, d3k8zb2, d3k8zc2, d3k8zd2, d3k8ze2, d3k8zf2 automated match to d1euza2 |
PDB Entry: 3k8z (more details), 2.4 Å
SCOPe Domain Sequences for d3k8zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8zc1 c.58.1.0 (C:17-188) automated matches {Bacillus subtilis [TaxId: 1423]} vlkstqtvihkaleklgypeevyellkepmrlltvkipvrmddgsvkiftgyrahndsvg ptkggirfhpnvtekevkalsiwmslkcgiidlpygggkggivcdprdmsfrelerlsrg yvraisqivgptkdvpapdvftnsqimawmmdeysridefnspgfitgkplv
Timeline for d3k8zc1: