SCOPe 2.08: Domain d3iwzd1: 3iwz D:22-158

Lineage for d3iwzd1 (3iwz D:22-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:340] [225796] (1 PDB entry)

8. Domain d3iwzd1: 3iwz D:22-158 [211995]
   Other proteins in same PDB: d3iwza2, d3iwzb2, d3iwzc2, d3iwzd2
   automated match to d2oz6a2

Details for d3iwzd1

PDB Entry: 3iwz, 2.3 Å

PDB Description: the c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris

PDB Compounds: (D:) Catabolite activation-like protein

SCOPe Domain Sequences for d3iwzd1:

Sequence; same for both SEQRES and ATOM records:

>d3iwzd1 b.82.3.0 (D:22-158) automated matches {Xanthomonas campestris [TaxId: 340]}
ldagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfg
sgefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvql
skrlldttrkasrlafl

Timeline for d3iwzd1:

• d3iwzd1 first appeared in SCOPe 2.03
  
• d3iwzd1 appears in SCOPe 2.07