PDB entry 3iwz

View 3iwz on RCSB PDB site
Description: The c-di-GMP Responsive Global Regulator CLP Links Cell-Cell Signaling to Virulence Gene Expression in Xanthomonas campestris
Class: Transcription
Keywords: Xcc, pathogenicity, CRP, CLP, c-di-GMP receptor, Quorum Sensing, DNA-binding, Transcription, Transcription regulation
Deposited on 2009-09-03, released 2009-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite activation-like protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwza1, d3iwza2
  • Chain 'B':
    Compound: Catabolite activation-like protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwzb1, d3iwzb2
  • Chain 'C':
    Compound: Catabolite activation-like protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwzc1, d3iwzc2
  • Chain 'D':
    Compound: Catabolite activation-like protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwzd1, d3iwzd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iwzA (A:)
    mslgnttvvtttvrnatpsltldagtierflahshrrryptrtdvfrpgdpagtlyyvis
    gsvsiiaeedddrelvlgyfgsgefvgemglfiesdtrevilrtrtqcelaeisyerlqq
    lfqtslspdaprilyaigvqlskrlldttrkasrlafldvtdrivrtlhdlskepeamsh
    pqgtqlrvsrqelarlvgcsremagrvlkklqadgllhargktvvlygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwzA (A:)
    ldagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfg
    sgefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvql
    skrlldttrkasrlafldvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsr
    emagrvlkklqadgllhargktvvlyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iwzB (B:)
    mslgnttvvtttvrnatpsltldagtierflahshrrryptrtdvfrpgdpagtlyyvis
    gsvsiiaeedddrelvlgyfgsgefvgemglfiesdtrevilrtrtqcelaeisyerlqq
    lfqtslspdaprilyaigvqlskrlldttrkasrlafldvtdrivrtlhdlskepeamsh
    pqgtqlrvsrqelarlvgcsremagrvlkklqadgllhargktvvlygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwzB (B:)
    ldagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfg
    sgefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvql
    skrlldttrkasrlafldvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsr
    emagrvlkklqadgllhargktvvlyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iwzC (C:)
    mslgnttvvtttvrnatpsltldagtierflahshrrryptrtdvfrpgdpagtlyyvis
    gsvsiiaeedddrelvlgyfgsgefvgemglfiesdtrevilrtrtqcelaeisyerlqq
    lfqtslspdaprilyaigvqlskrlldttrkasrlafldvtdrivrtlhdlskepeamsh
    pqgtqlrvsrqelarlvgcsremagrvlkklqadgllhargktvvlygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwzC (C:)
    dagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfgs
    gefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvqls
    krlldttrkasrlafldvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsre
    magrvlkklqadgllhargktvvlygt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iwzD (D:)
    mslgnttvvtttvrnatpsltldagtierflahshrrryptrtdvfrpgdpagtlyyvis
    gsvsiiaeedddrelvlgyfgsgefvgemglfiesdtrevilrtrtqcelaeisyerlqq
    lfqtslspdaprilyaigvqlskrlldttrkasrlafldvtdrivrtlhdlskepeamsh
    pqgtqlrvsrqelarlvgcsremagrvlkklqadgllhargktvvlygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwzD (D:)
    ldagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfg
    sgefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvql
    skrlldttrkasrlafldvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsr
    emagrvlkklqadgllhargktvvlygt