SCOPe 2.08: Domain d3iwza2: 3iwz A:159-228

Lineage for d3iwza2 (3iwz A:159-228)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:340] [225797] (1 PDB entry)

8. Domain d3iwza2: 3iwz A:159-228 [211990]
   Other proteins in same PDB: d3iwza1, d3iwzb1, d3iwzc1, d3iwzd1
   automated match to d2oz6a1

Details for d3iwza2

PDB Entry: 3iwz, 2.3 Å

PDB Description: the c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris

PDB Compounds: (A:) Catabolite activation-like protein

SCOPe Domain Sequences for d3iwza2:

Sequence; same for both SEQRES and ATOM records:

>d3iwza2 a.4.5.0 (A:159-228) automated matches {Xanthomonas campestris [TaxId: 340]}
dvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsremagrvlkklqadgllh
argktvvlyg

Timeline for d3iwza2:

• d3iwza2 first appeared in SCOPe 2.03
  
• d3iwza2 appears in SCOPe 2.07