| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Xanthomonas campestris [TaxId:340] [225797] (1 PDB entry) |
| Domain d3iwzb2: 3iwz B:159-228 [211992] Other proteins in same PDB: d3iwza1, d3iwzb1, d3iwzc1, d3iwzd1 automated match to d2oz6a1 |
PDB Entry: 3iwz (more details), 2.3 Å
SCOPe Domain Sequences for d3iwzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwzb2 a.4.5.0 (B:159-228) automated matches {Xanthomonas campestris [TaxId: 340]}
dvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsremagrvlkklqadgllh
argktvvlyg
Timeline for d3iwzb2: