Lineage for d2oz6a2 (2oz6 A:9-142)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Cyclic AMP receptor-like protein Vfr [159312] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [159313] (1 PDB entry)
Uniprot P55222 9-142
Domain d2oz6a2: 2oz6 A:9-142 [149104]
Other proteins in same PDB: d2oz6a1
protein/DNA complex; complexed with cmp
Details for d2oz6a2
PDB Entry: 2oz6 (more details), 2.8 Å
PDB Description: crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
PDB Compounds: (A:) Virulence Factor RegulatorSCOPe Domain Sequences for d2oz6a2:
Sequence, based on SEQRES records: (download)
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns
gdffgelglfekegseqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadr
lrkttrkvgdlafl
Sequence, based on observed residues (ATOM records): (download)
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns
gdffgelglfeqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadrlrktt
rkvgdlafl
SCOPe Domain Coordinates for d2oz6a2:
Click to download the PDB-style file with coordinates for d2oz6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oz6a2:
- d2oz6a2 first appeared in SCOP 1.75
- d2oz6a2 appears in SCOPe 2.07
View in 3D
