Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab GH1002 (mouse), kappa L chain [49033] (1 PDB entry) |
Domain d1ghfh2: 1ghf H:116-213 [21139] Other proteins in same PDB: d1ghfh1, d1ghfl1 |
PDB Entry: 1ghf (more details), 2.7 Å
SCOP Domain Sequences for d1ghfh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghfh2 b.1.1.2 (H:116-213) Immunoglobulin (constant domains of L and H chains) {Fab GH1002 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkii
Timeline for d1ghfh2: