SCOP 1.55: Domain d1ghfh1: 1ghf H:1-115

Lineage for d1ghfh1 (1ghf H:1-115)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab GH1002 (mouse), kappa L chain [48817] (1 PDB entry)

8. Domain d1ghfh1: 1ghf H:1-115 [20109]
   Other proteins in same PDB: d1ghfh2, d1ghfl2

Details for d1ghfh1

PDB Entry: 1ghf, 2.7 Å

PDB Description: anti-anti-idiotype gh1002 fab fragment

SCOP Domain Sequences for d1ghfh1:

Sequence; same for both SEQRES and ATOM records:

>d1ghfh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab GH1002 (mouse), kappa L chain}
vqlqqsgpelkkpgetvkiscklwytftdygmnwvkqapgkglkwmgwiqtnteeptyga
efkgrfafsletsaftaykqinnlknedmatyfcarveagfdywaqgttltvss

Timeline for d1ghfh1:

• d1ghfh1 appears in SCOP 1.57
  
• d1ghfh1 appears in the current release, SCOPe 2.08