Lineage for d1ghfl1 (1ghf L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7685Species Fab GH1002 (mouse), kappa L chain [48817] (1 PDB entry)
  8. 7687Domain d1ghfl1: 1ghf L:1-107 [20108]
    Other proteins in same PDB: d1ghfh2, d1ghfl2

Details for d1ghfl1

PDB Entry: 1ghf (more details), 2.7 Å

PDB Description: anti-anti-idiotype gh1002 fab fragment

SCOP Domain Sequences for d1ghfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab GH1002 (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscresqdisnslnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgtgtdysltisnleqedfatyfcqqgntlpytfgggtkleik

SCOP Domain Coordinates for d1ghfl1:

Click to download the PDB-style file with coordinates for d1ghfl1.
(The format of our PDB-style files is described here.)

Timeline for d1ghfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ghfl2