SCOPe 2.08: Domain d3h1sb1: 3h1s B:1-83

Lineage for d3h1sb1 (3h1s B:1-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [225665] (1 PDB entry)

8. Domain d3h1sb1: 3h1s B:1-83 [210782]
   Other proteins in same PDB: d3h1sa2, d3h1sb2
   automated match to d1jr9a1
   complexed with fe, gol

Details for d3h1sb1

PDB Entry: 3h1s, 1.9 Å

PDB Description: crystal structure of superoxide dismutase from francisella tularensis subsp. tularensis schu s4

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d3h1sb1:

Sequence; same for both SEQRES and ATOM records:

>d3h1sb1 a.2.11.0 (B:1-83) automated matches {Francisella tularensis [TaxId: 119856]}
mkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivkts
nggifnnaaqvfnhtfywncltp

Timeline for d3h1sb1:

• d3h1sb1 first appeared in SCOPe 2.03
  
• d3h1sb1 appears in SCOPe 2.07