PDB entry 3h1s

View 3h1s on RCSB PDB site
Description: Crystal structure of superoxide dismutase from Francisella tularensis subsp. tularensis SCHU S4
Class: oxidoreductase
Keywords: sobD, superoxide dismutase, CSGID, Oxidoreductase, Structural Genomics, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-04-13, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: sodB, FTT0068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h1sa1, d3h1sa2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: sodB, FTT0068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h1sb1, d3h1sb2
  • Heterogens: FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h1sA (A:)
    snamkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeiv
    ktsnggifnnaaqvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiat
    fgsgwawlvkntegkleivttsnagcpltenkkplltfdvwehayyidyrnarpkyveal
    wdivnwqfvseqfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h1sA (A:)
    kfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivktsn
    ggifnnaaqvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiatfgsg
    wawlvkntegkleivttsnagcpltenkkplltfdvwehayyidyrnarpkyvealwdiv
    nwqfvseqfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h1sB (B:)
    snamkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeiv
    ktsnggifnnaaqvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiat
    fgsgwawlvkntegkleivttsnagcpltenkkplltfdvwehayyidyrnarpkyveal
    wdivnwqfvseqfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h1sB (B:)
    mkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivkts
    nggifnnaaqvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiatfgs
    gwawlvkntegkleivttsnagcpltenkkplltfdvwehayyidyrnarpkyvealwdi
    vnwqfvseqfad