Lineage for d3h1sa2 (3h1s A:84-191)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (34 species)
    not a true protein
  7. 2514077Species Francisella tularensis [TaxId:119856] [225666] (1 PDB entry)
  8. 2514078Domain d3h1sa2: 3h1s A:84-191 [210781]
    Other proteins in same PDB: d3h1sa1, d3h1sb1
    automated match to d1jr9a2
    complexed with fe, gol

Details for d3h1sa2

PDB Entry: 3h1s (more details), 1.9 Å

PDB Description: crystal structure of superoxide dismutase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3h1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1sa2 d.44.1.0 (A:84-191) automated matches {Francisella tularensis [TaxId: 119856]}
nkteassqlkaalietfgsvenfkeqfskaaiatfgsgwawlvkntegkleivttsnagc
pltenkkplltfdvwehayyidyrnarpkyvealwdivnwqfvseqfa

SCOPe Domain Coordinates for d3h1sa2:

Click to download the PDB-style file with coordinates for d3h1sa2.
(The format of our PDB-style files is described here.)

Timeline for d3h1sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h1sa1