Lineage for d3h1sa1 (3h1s A:2-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690429Species Francisella tularensis [TaxId:119856] [225665] (1 PDB entry)
  8. 2690430Domain d3h1sa1: 3h1s A:2-83 [210780]
    Other proteins in same PDB: d3h1sa2, d3h1sb2
    automated match to d1jr9a1
    complexed with fe, gol

Details for d3h1sa1

PDB Entry: 3h1s (more details), 1.9 Å

PDB Description: crystal structure of superoxide dismutase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3h1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1sa1 a.2.11.0 (A:2-83) automated matches {Francisella tularensis [TaxId: 119856]}
kfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivktsn
ggifnnaaqvfnhtfywncltp

SCOPe Domain Coordinates for d3h1sa1:

Click to download the PDB-style file with coordinates for d3h1sa1.
(The format of our PDB-style files is described here.)

Timeline for d3h1sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h1sa2