SCOPe 2.08: Domain d3e5xa2: 3e5x A:148-222

Lineage for d3e5xa2 (3e5x A:148-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Chlorophenol reduction protein CprK [158268] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
   Uniprot Q18R04 148-227! Uniprot Q18R04 148-229

8. Domain d3e5xa2: 3e5x A:148-222 [209389]
   Other proteins in same PDB: d3e5xa1, d3e5xb1, d3e5xc1, d3e5xd1
   automated match to d2h6ba1
   complexed with 3c4

Details for d3e5xa2

PDB Entry: 3e5x, 2 Å

PDB Description: OCPA complexed CprK

PDB Compounds: (A:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5xa2:

Sequence; same for both SEQRES and ATOM records:

>d3e5xa2 a.4.5.4 (A:148-222) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaclkrenil
dkkknkiivynlgel

Timeline for d3e5xa2:

• d3e5xa2 first appeared in SCOPe 2.03
  
• d3e5xa2 appears in SCOPe 2.07