PDB entry 3e5x

View 3e5x on RCSB PDB site
Description: OCPA complexed CprK
Class: transcription regulation
Keywords: CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION
Deposited on 2008-08-14, released 2008-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e5xa1, d3e5xa2
  • Chain 'B':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e5xb1, d3e5xb2
  • Chain 'C':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e5xc1, d3e5xc2
  • Chain 'D':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e5xd1, d3e5xd2
  • Heterogens: 3C4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5xA (A:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5xA (A:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaclkrenildkkknkiivynlgel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e5xB (B:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5xB (B:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaclkrenildkkknkiivynlgelkhlse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e5xC (C:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5xC (C:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaclkrenildkkknkiivynlgel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e5xD (D:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5xD (D:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaclkrenildkkknkiivynlgelkhlseq