SCOPe 2.08: Domain d3e5xd1: 3e5x D:9-147

Lineage for d3e5xd1 (3e5x D:9-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Chlorophenol reduction protein CprK [159314] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
   Uniprot Q18R04 3-147! Uniprot Q18R04 9-147

8. Domain d3e5xd1: 3e5x D:9-147 [209394]
   Other proteins in same PDB: d3e5xa2, d3e5xb2, d3e5xc2, d3e5xd2
   automated match to d2h6ba2
   complexed with 3c4

Details for d3e5xd1

PDB Entry: 3e5x, 2 Å

PDB Description: OCPA complexed CprK

PDB Compounds: (D:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5xd1:

Sequence; same for both SEQRES and ATOM records:

>d3e5xd1 b.82.3.2 (D:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
nyltkvayyarqvaemnty

Timeline for d3e5xd1:

• d3e5xd1 first appeared in SCOPe 2.03
  
• d3e5xd1 appears in SCOPe 2.07