Lineage for d2h6ba1 (2h6b A:148-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693062Protein Chlorophenol reduction protein CprK [158268] (2 species)
  7. 2693066Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
    Uniprot Q18R04 148-227! Uniprot Q18R04 148-229
  8. 2693078Domain d2h6ba1: 2h6b A:148-229 [147228]
    Other proteins in same PDB: d2h6ba2, d2h6ba3, d2h6bb2, d2h6bb3
    protein/DNA complex; complexed with 3c4, so4

Details for d2h6ba1

PDB Entry: 2h6b (more details), 2.2 Å

PDB Description: Crystal structure of oxidized CprK in complex with o-chlorophenolacetic acid
PDB Compounds: (A:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ba1 a.4.5.4 (A:148-229) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaclkrenil
dkkknkiivynlgelkhlseqt

SCOPe Domain Coordinates for d2h6ba1:

Click to download the PDB-style file with coordinates for d2h6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2h6ba1: