PDB entry 2h6b

View 2h6b on RCSB PDB site
Description: Crystal structure of oxidized CprK in complex with o-chlorophenolacetic acid
Class: DNA binding protein
Keywords: halorespiration, DNA binding, chlorinated ligand, chlorophenol, CprK, helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2006-05-31, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ChloroPhenol Reduction gene K
    Species: Desulfitobacterium hafniense [TaxId:49338]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h6ba1, d2h6ba2, d2h6ba3
  • Chain 'B':
    Compound: ChloroPhenol Reduction gene K
    Species: Desulfitobacterium hafniense [TaxId:49338]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h6bb1, d2h6bb2, d2h6bb3
  • Heterogens: SO4, 3C4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6bA (A:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6bA (A:)
    veglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkik
    ldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedm
    ifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqks
    igeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsvdklaaaldhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6bB (B:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6bB (B:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaclkrenildkkknkiivynlgelkhlseqtsyysdpnsssvdkl