SCOPe 2.07: Domain d2h6ba1: 2h6b A:148-229

Lineage for d2h6ba1 (2h6b A:148-229)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Chlorophenol reduction protein CprK [158268] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
   Uniprot Q18R04 148-227! Uniprot Q18R04 148-229

8. Domain d2h6ba1: 2h6b A:148-229 [147228]
   Other proteins in same PDB: d2h6ba2, d2h6ba3, d2h6bb2, d2h6bb3
   protein/DNA complex; complexed with 3c4, so4

Details for d2h6ba1

PDB Entry: 2h6b, 2.2 Å

PDB Description: Crystal structure of oxidized CprK in complex with o-chlorophenolacetic acid

PDB Compounds: (A:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6ba1:

Sequence; same for both SEQRES and ATOM records:

>d2h6ba1 a.4.5.4 (A:148-229) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaclkrenil
dkkknkiivynlgelkhlseqt

Timeline for d2h6ba1:

• d2h6ba1 first appeared in SCOP 1.75
  
• d2h6ba1 appears in SCOPe 2.06
  
• d2h6ba1 appears in the current release, SCOPe 2.08