SCOPe 2.08: Domain d2h6bb2: 2h6b B:9-147

Lineage for d2h6bb2 (2h6b B:9-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Chlorophenol reduction protein CprK [159314] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
   Uniprot Q18R04 3-147! Uniprot Q18R04 9-147

8. Domain d2h6bb2: 2h6b B:9-147 [147231]
   Other proteins in same PDB: d2h6ba1, d2h6ba3, d2h6bb1, d2h6bb3
   automated match to d2h6ba2
   protein/DNA complex; complexed with 3c4, so4

Details for d2h6bb2

PDB Entry: 2h6b, 2.2 Å

PDB Description: Crystal structure of oxidized CprK in complex with o-chlorophenolacetic acid

PDB Compounds: (B:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6bb2:

Sequence; same for both SEQRES and ATOM records:

>d2h6bb2 b.82.3.2 (B:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
nyltkvayyarqvaemnty

Timeline for d2h6bb2:

• d2h6bb2 first appeared in SCOP 1.75
  
• d2h6bb2 appears in SCOPe 2.07