Lineage for d2mhac1 (2mha C:182-270)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8326Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries)
  8. 8347Domain d2mhac1: 2mha C:182-270 [20805]
    Other proteins in same PDB: d2mhaa2, d2mhac2

Details for d2mhac1

PDB Entry: 2mha (more details), 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhac1 b.1.1.2 (C:182-270) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl

SCOP Domain Coordinates for d2mhac1:

Click to download the PDB-style file with coordinates for d2mhac1.
(The format of our PDB-style files is described here.)

Timeline for d2mhac1: