Lineage for d2mhac1 (2mha C:182-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747308Domain d2mhac1: 2mha C:182-270 [20805]
    Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_

Details for d2mhac1

PDB Entry: 2mha (more details), 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (C:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOPe Domain Sequences for d2mhac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhac1 b.1.1.2 (C:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl

SCOPe Domain Coordinates for d2mhac1:

Click to download the PDB-style file with coordinates for d2mhac1.
(The format of our PDB-style files is described here.)

Timeline for d2mhac1: