SCOP 1.55: Domain d2mhab1: 2mha B:

Lineage for d2mhab1 (2mha B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries)

8. Domain d2mhab1: 2mha B: [20804]
   Other proteins in same PDB: d2mhaa2, d2mhac2

Details for d2mhab1

PDB Entry: 2mha, 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhab1:

Sequence; same for both SEQRES and ATOM records:

>d2mhab1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2mhab1:

• d2mhab1 appears in SCOP 1.57
  
• d2mhab1 appears in the current release, SCOPe 2.08, called d2mhab_