![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [225360] (5 PDB entries) |
![]() | Domain d2rcyd2: 2rcy D:157-262 [206081] Other proteins in same PDB: d2rcya1, d2rcya3, d2rcyb1, d2rcyc1, d2rcyd1, d2rcye1 automated match to d2ahra1 complexed with gol, mg, nap |
PDB Entry: 2rcy (more details), 2.3 Å
SCOPe Domain Sequences for d2rcyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcyd2 a.100.1.0 (D:157-262) automated matches {Plasmodium falciparum [TaxId: 36329]} kdmdiataisgcgpayvylfieslidagvknglsrelsknlvlqtikgsvemvkksdqpv qqlkdnivspggitavglysleknsfkytvmnaveaacekskamgs
Timeline for d2rcyd2: