| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries) |
| Domain d2rcya1: 2rcy A:2-156 [206074] Other proteins in same PDB: d2rcya2, d2rcya3, d2rcyb2, d2rcyc2, d2rcyd2, d2rcye2 automated match to d2ahra2 complexed with gol, mg, nap |
PDB Entry: 2rcy (more details), 2.3 Å
SCOPe Domain Sequences for d2rcya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcya1 c.2.1.0 (A:2-156) automated matches {Plasmodium falciparum [TaxId: 36329]}
meniklgfmglgqmgsalahgiananiikkenlfyygpskknttlnymssneelarhcdi
ivcavkpdiagsvlnnikpylsskllisicgglnigkleemvgsenkivwvmpntpclvg
egsfiycsnknvnstdkkyvndifnscgiiheike
Timeline for d2rcya1: