Lineage for d2rcye1 (2rcy E:7-156)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848010Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries)
  8. 2848017Domain d2rcye1: 2rcy E:7-156 [206082]
    Other proteins in same PDB: d2rcya2, d2rcya3, d2rcyb2, d2rcyc2, d2rcyd2, d2rcye2
    automated match to d2ahra2
    complexed with gol, mg, nap

Details for d2rcye1

PDB Entry: 2rcy (more details), 2.3 Å

PDB Description: crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
PDB Compounds: (E:) Pyrroline carboxylate reductase

SCOPe Domain Sequences for d2rcye1:

Sequence, based on SEQRES records: (download)

>d2rcye1 c.2.1.0 (E:7-156) automated matches {Plasmodium falciparum [TaxId: 36329]}
lgfmglgqmgsalahgiananiikkenlfyygpskknttlnymssneelarhcdiivcav
kpdiagsvlnnikpylsskllisicgglnigkleemvgsenkivwvmpntpclvgegsfi
ycsnknvnstdkkyvndifnscgiiheike

Sequence, based on observed residues (ATOM records): (download)

>d2rcye1 c.2.1.0 (E:7-156) automated matches {Plasmodium falciparum [TaxId: 36329]}
lgfmglgqmgsalahgiananlfyygpskknttlnymssneearhiivcavkpdiagsvl
nnikpylsskllisicgglnigkleemvgsivwvmpntpclvgegsfiycsnknvnstdk
kyvndifnscgiiheike

SCOPe Domain Coordinates for d2rcye1:

Click to download the PDB-style file with coordinates for d2rcye1.
(The format of our PDB-style files is described here.)

Timeline for d2rcye1: