SCOPe 2.03: Domain d2rcyd2: 2rcy D:157-262

Lineage for d2rcyd2 (2rcy D:157-262)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (23 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225360] (1 PDB entry)

8. Domain d2rcyd2: 2rcy D:157-262 [206081]
   Other proteins in same PDB: d2rcya1, d2rcyb1, d2rcyc1, d2rcyd1, d2rcye1
   automated match to d2ahra1
   complexed with gol, mg, nap

Details for d2rcyd2

PDB Entry: 2rcy, 2.3 Å

PDB Description: crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound

PDB Compounds: (D:) Pyrroline carboxylate reductase

SCOPe Domain Sequences for d2rcyd2:

Sequence; same for both SEQRES and ATOM records:

>d2rcyd2 a.100.1.0 (D:157-262) automated matches {Plasmodium falciparum [TaxId: 36329]}
kdmdiataisgcgpayvylfieslidagvknglsrelsknlvlqtikgsvemvkksdqpv
qqlkdnivspggitavglysleknsfkytvmnaveaacekskamgs

Timeline for d2rcyd2:

• d2rcyd2 is new in SCOPe 2.03-stable
  
• d2rcyd2 appears in SCOPe 2.04
  
• d2rcyd2 appears in the current release, SCOPe 2.08