Lineage for d2rcye2 (2rcy E:157-262)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721881Species Plasmodium falciparum [TaxId:36329] [225360] (5 PDB entries)
  8. 2721888Domain d2rcye2: 2rcy E:157-262 [206083]
    Other proteins in same PDB: d2rcya1, d2rcya3, d2rcyb1, d2rcyc1, d2rcyd1, d2rcye1
    automated match to d2ahra1
    complexed with gol, mg, nap

Details for d2rcye2

PDB Entry: 2rcy (more details), 2.3 Å

PDB Description: crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
PDB Compounds: (E:) Pyrroline carboxylate reductase

SCOPe Domain Sequences for d2rcye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcye2 a.100.1.0 (E:157-262) automated matches {Plasmodium falciparum [TaxId: 36329]}
kdmdiataisgcgpayvylfieslidagvknglsrelsknlvlqtikgsvemvkksdqpv
qqlkdnivspggitavglysleknsfkytvmnaveaacekskamgs

SCOPe Domain Coordinates for d2rcye2:

Click to download the PDB-style file with coordinates for d2rcye2.
(The format of our PDB-style files is described here.)

Timeline for d2rcye2: