SCOP 1.55: Domain d1ejoh1: 1ejo H:2501-2619

Lineage for d1ejoh1 (1ejo H:2501-2619)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [48890] (1 PDB entry)

8. Domain d1ejoh1: 1ejo H:2501-2619 [20429]
   Other proteins in same PDB: d1ejoh2, d1ejol2

Details for d1ejoh1

PDB Entry: 1ejo, 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejoh1:

Sequence; same for both SEQRES and ATOM records:

>d1ejoh1 b.1.1.1 (H:2501-2619) Immunoglobulin (variable domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
qmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyyp
dsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsa

Timeline for d1ejoh1:

• d1ejoh1 appears in SCOP 1.57
  
• d1ejoh1 appears in the current release, SCOPe 2.08