Lineage for d1ejoh2 (1ejo H:2620-2719)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8492Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [49097] (1 PDB entry)
  8. 8493Domain d1ejoh2: 1ejo H:2620-2719 [21399]
    Other proteins in same PDB: d1ejoh1, d1ejol1

Details for d1ejoh2

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejoh2:

Sequence, based on SEQRES records: (download)

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin (constant domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
akttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin (constant domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
akttapsvyplapvcgsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ejoh2:

Click to download the PDB-style file with coordinates for d1ejoh2.
(The format of our PDB-style files is described here.)

Timeline for d1ejoh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejoh1