Lineage for d2csdb4 (2csd B:410-464)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715699Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein)
    this is a repeat family; one repeat unit is 2csb A:351-409 found in domain
  6. 2715700Protein Topoisomerase V [140627] (1 species)
  7. 2715701Species Methanopyrus kandleri [TaxId:2320] [140628] (2 PDB entries)
    Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519
  8. 2715716Domain d2csdb4: 2csd B:410-464 [203830]
    Other proteins in same PDB: d2csda1, d2csdb1
    automated match to d2csba3

Details for d2csdb4

PDB Entry: 2csd (more details), 2.9 Å

PDB Description: crystal structure of topoisomerase v (61 kda fragment)
PDB Compounds: (B:) Topoisomerase V

SCOPe Domain Sequences for d2csdb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csdb4 a.60.2.4 (B:410-464) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]}
laeltkkegvgrktaerllrafgnpervkqlarefeieklasvegvgervlrslv

SCOPe Domain Coordinates for d2csdb4:

Click to download the PDB-style file with coordinates for d2csdb4.
(The format of our PDB-style files is described here.)

Timeline for d2csdb4: