SCOPe 2.04: Domain d4g7he_: 4g7h E:

Lineage for d4g7he_ (4g7h E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)

8. Domain d4g7he_: 4g7h E: [202199]
   Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7hp1, d4g7hp2, d4g7hp3
   automated match to d2o5ie_
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7he_

PDB Entry: 4g7h, 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex

PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4g7he_:

Sequence; same for both SEQRES and ATOM records:

>d4g7he_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

Timeline for d4g7he_:

• d4g7he_ first appeared in SCOPe 2.03
  
• d4g7he_ appears in SCOPe 2.05
  
• d4g7he_ appears in the current release, SCOPe 2.08