| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (3 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries) |
| Domain d2o5ie_: 2o5i E: [148602] Other proteins in same PDB: d2o5ia1, d2o5ia2, d2o5ib1, d2o5ib2, d2o5ic_, d2o5id_, d2o5ik1, d2o5ik2, d2o5il1, d2o5il2, d2o5im_, d2o5in_ automated match to d1i6ve_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2o5i (more details), 2.5 Å
SCOPe Domain Sequences for d2o5ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5ie_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve
Timeline for d2o5ie_: