Lineage for d4g7hb1 (4g7h B:7-49,B:173-228)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657042Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1657043Protein RNA polymerase alpha [55259] (3 species)
  7. 1657058Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1657060Domain d4g7hb1: 4g7h B:7-49,B:173-228 [202196]
    Other proteins in same PDB: d4g7ha2, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk2, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3
    automated match to d1smya1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7hb1

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7hb1 d.74.3.1 (B:7-49,B:173-228) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
kapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlgq
rtdldkltlriwtdgsvtplealnqaveilrehltyfsnp

SCOPe Domain Coordinates for d4g7hb1:

Click to download the PDB-style file with coordinates for d4g7hb1.
(The format of our PDB-style files is described here.)

Timeline for d4g7hb1: