Class a: All alpha proteins [46456] (285 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.0: automated matches [254327] (1 protein) not a true family |
Protein automated matches [254748] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [256265] (2 PDB entries) |
Domain d4g7hf1: 4g7h F:78-257 [240146] Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp2, d4g7hp3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7h (more details), 2.9 Å
SCOPe Domain Sequences for d4g7hf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7hf1 a.177.1.0 (F:78-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
Timeline for d4g7hf1: