| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein automated matches [190193] (2 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [187312] (3 PDB entries) |
| Domain d4g7he_: 4g7h E: [202199] Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_ automated match to d2o5ie_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7h (more details), 2.9 Å
SCOPe Domain Sequences for d4g7he_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7he_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv
Timeline for d4g7he_: