Lineage for d4g7ho_ (4g7h O:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1284134Protein automated matches [190193] (2 species)
    not a true protein
  7. 1284148Species Thermus thermophilus [TaxId:300852] [187312] (3 PDB entries)
  8. 1284150Domain d4g7ho_: 4g7h O: [194416]
    Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_
    automated match to d3eqle_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ho_

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (O:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4g7ho_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7ho_ a.143.1.1 (O:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4g7ho_:

Click to download the PDB-style file with coordinates for d4g7ho_.
(The format of our PDB-style files is described here.)

Timeline for d4g7ho_: